Phone: 1-617-401-8149
Fax: 1-617-606-5019
Email: message@sydlabs.com
Or leave a message with a formal purchase
order (PO) Or credit card.
Catalog No. | Product Name | Size | List Price (US$) | Quantity |
---|
The research grade semaglutide biosimilar and synthetic peptide are both for research use only (RUO).
Price/availability/specifications subject to change without notice. Unless otherwise indicated, our catalog and customized products are for research use only and not intended for human or animal diagnostic or therapeutic use.
Phone: 1-617-401-8149
Fax: 1-617-606-5019
Email: message@sydlabs.com
Or leave a message with a formal purchase
order (PO) Or credit card.
Source: The recombinant peptide semaglutide biosimilar was produced in the semaglutide stable cell line.
Sequence: HXEGTFTSDVSSYLEGQAAKEFIAWLVRGRG.
CAS No.: 910463-68-2.
Molecular Formula: C187H291N45O59.
Molecular Weight: 4113.6.
Applications: ELISA, functional assays such as bioanalytical PK and ADA assays, and those assays for studying biological pathways affected by semaglutide.
Form of Peptide: lyophilized from 0.2 uM filtered solution, no stabilizers or preservatives.
Endotoxin: < 1 EU per 1 mg of the peptide by the LAL method.
Purity: >95% by SDS-PAGE under reducing conditions and HPLC.
Shipping: The research grade semaglutide biosimilar is shipped with ice pack. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage: Use a manual defrost freezer and avoid repeated freeze-thaw cycles.
12 months from date of receipt, -20 to -70°C as supplied.
1 month from date of receipt, 2 to 8°C as supplied.
Source: The semaglutide peptide was synthesized.
Sequence: HXEGTFTSDVSSYLEGQAAKEFIAWLVRGRG.
CAS No.: 910463-68-2.
Molecular Formula: C187H291N45O59.
Molecular Weight: 4113.6.
Applications: ELISA, functional assays such as bioanalytical PK and ADA assays, and those assays for studying biological pathways affected by semaglutide.
Form of Peptide: lyophilized, no stabilizers or preservatives.
Purity: >95% by HPLC.
Shipping: The research grade semaglutide biosimilar is shipped at ambient temperature. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage: Use a manual defrost freezer and avoid repeated freeze-thaw cycles.
12 months from date of receipt, -20 to -70°C as supplied.
1 month from date of receipt, 2 to 8°C as supplied.
Background
What is research grade semaglutide biosimilar? Research grade semaglutide biosimilar has the same amino acid sequence as semaglutide, a recombinant peptide which presents 94% sequence homology to the human glucagon-like peptide-1 (GLP-1), differing primarily by two amino-acid substitutions at positions 8 and 34, where alanine and lysine are replaced by 2-aminoisobutyric acid and arginine, respectively. Liraglutide is made by attaching a C-18 fatty acid (stearic diacid) with a glutamic acid spacer on the remaining lysine residue at position 26 of the peptide precursor. Semaglutide is resistant to the dipeptidylpeptidase-4 enzyme whic degrades the natural hormone. As a GLP-1 receptor agonist, Semaglutide mimics the action of the human incretin glucagon-like peptide-1 (GLP-1), thereby increasing insulin secretion and increasing blood sugar disposal and improving glycemic control. Semaglutide is an anti-diabetic medication used to treat type 2 diabetes, obesity, and chronic weight management.
Syd Labs also provides the following GLP-1 receptor agonist biosimilar peptide:
Liraglutide biosimilar
Copyright © 2009-2025 sydlabs.com. All rights reserved.
Use of this website means that you have read, understood, and accepted the Syd Labs Privacy Policy and Terms & Conditions.
Friend Link: Ushelf