My Cart [ 0 ]
Home > Antibodies > Research-Grade Biosimilars > Semaglutide Biosimilar

Semaglutide Biosimilar

Acylated Glucagon-like Peptide-1 Receptor Agonist, Human GLP-1 Receptor Agonist, Human GLP-1 Analog

Catalog No. Product Name Size List Price (US$) Quantity
C074P Semaglutide Biosimilar 20 mg 175.00
C074P Semaglutide Biosimilar 60 mg 350.00
C074P Semaglutide Biosimilar 180 mg 700.00
C074PS Semaglutide Synthetic Peptide 200 mg 400.00
C074PS Semaglutide Synthetic Peptide 1 g 800.00
C074PS Semaglutide Synthetic Peptide 5 g 3200.00
Description

C074P: Semaglutide Biosimilar

Source: The recombinant peptide semaglutide biosimilar was produced in the semaglutide stable cell line. 
Sequence: HXEGTFTSDVSSYLEGQAAKEFIAWLVRGRG.
CAS No.: 910463-68-2.
Molecular Formula: C187H291N45O59.
Molecular Weight: 4113.6.
Applications: ELISA, functional assays such as bioanalytical PK and ADA assays, and those assays for studying biological pathways affected by semaglutide.
Form of Peptide: lyophilized from 0.2 uM filtered solution, no stabilizers or preservatives.
Endotoxin: < 1 EU per 1 mg of the peptide by the LAL method.
Purity: >95% by SDS-PAGE under reducing conditions and HPLC.

Shipping: The research grade semaglutide biosimilar is shipped with ice pack. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage: Use a manual defrost freezer and avoid repeated freeze-thaw cycles.
12 months from date of receipt, -20 to -70°C as supplied.
1 month from date of receipt, 2 to 8°C as supplied.

C074PS: Semaglutide Synthetic Peptide

Source: The semaglutide peptide was synthesized. 
Sequence: HXEGTFTSDVSSYLEGQAAKEFIAWLVRGRG.
CAS No.: 910463-68-2.
Molecular Formula: C187H291N45O59.
Molecular Weight: 4113.6.
Applications: ELISA, functional assays such as bioanalytical PK and ADA assays, and those assays for studying biological pathways affected by semaglutide.
Form of Peptide: lyophilized, no stabilizers or preservatives.
Purity: >95% by HPLC.

Shipping: The research grade semaglutide biosimilar is shipped at ambient temperature. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage: Use a manual defrost freezer and avoid repeated freeze-thaw cycles.
12 months from date of receipt, -20 to -70°C as supplied.
1 month from date of receipt, 2 to 8°C as supplied.

Background

What is research grade semaglutide biosimilar? Research grade semaglutide biosimilar has the same amino acid sequence as semaglutide, a recombinant peptide which presents 94% sequence homology to the human glucagon-like peptide-1 (GLP-1), differing primarily by two amino-acid substitutions at positions 8 and 34, where alanine and lysine are replaced by 2-aminoisobutyric acid and arginine, respectively. Liraglutide is made by attaching a C-18 fatty acid (stearic diacid) with a glutamic acid spacer on the remaining lysine residue at position 26 of the peptide precursor. Semaglutide is resistant to the dipeptidylpeptidase-4 enzyme whic degrades the natural hormone. As a GLP-1 receptor agonist, Semaglutide mimics the action of the human incretin glucagon-like peptide-1 (GLP-1), thereby increasing insulin secretion and increasing blood sugar disposal and improving glycemic control. Semaglutide is an anti-diabetic medication used to treat type 2 diabetes, obesity, and chronic weight management.

Syd Labs also provides the following GLP-1 receptor agonist biosimilar peptide:
Liraglutide biosimilar

Related Links

See our Privacy Policy