My Cart [ 0 ]
Home > Antibodies > Research-Grade Biosimilars > Liraglutide Biosimilar

Liraglutide Biosimilar

Acylated Glucagon-like Peptide-1 Receptor Agonist, Human GLP-1 Receptor Agonist, Human GLP-1 Analog

Catalog No. Product Name Size List Price (US$) Quantity
C073P Liraglutide Biosimilar 18 mg 175.00
C073P Liraglutide Biosimilar 54 mg 300.00
C073P Liraglutide Biosimilar 108 mg 500.00
Description

C073P: Liraglutide Biosimilar

Source: The recombinant peptide liraglutide biosimilar was produced in the liraglutide stable cell line. 
Sequence: HAEGTFTSDVSSYLEGQAAKEEFIAWLVRGRG (gamma-E-palmitoyl at E21).
CAS No.: 204656-20-2.
Molecular Formula: C172H265N43O51.
Molecular Weight: 3751.2.
Applications: ELISA, functional assays such as bioanalytical PK and ADA assays, and those assays for studying biological pathways affected by liraglutide.
Form of Peptide: lyophilized from 0.2 uM filtered solution, no stabilizers or preservatives.
Endotoxin: < 1 EU per 1 mg of the peptide by the LAL method.
Purity: >95% by SDS-PAGE under reducing conditions and HPLC.

Shipping: The research grade liraglutide biosimilar is shipped with ice pack. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage: Use a manual defrost freezer and avoid repeated freeze-thaw cycles.
12 months from date of receipt, -20 to -70°C as supplied.
1 month from date of receipt, 2 to 8°C as supplied.

Background

What is research grade liraglutide biosimilar? Research grade liraglutide biosimilar has the same amino acid sequence as Liraglutide, a recombinant peptide which presents 97% homology with human glucagon-like peptide-1 (GLP-1), differing primarily by substituting arginine for lysine at position 34. Liraglutide is made by attaching a C-16 fatty acid (palmitic acid) with a glutamic acid spacer on the remaining lysine residue at position 26 of the peptide precursor. Liraglutide is resistant to the dipeptidylpeptidase-4 enzyme whic degrades the natural hormone. As a glucagon-like peptide-1 receptor agonist (GLP-1 receptor agonist) also known as incretin mimetics, Liraglutide actives the GLP-1 receptor and exerts an incretin mimetic effect during at least 24 hours after a single subcutaneous injection. Besides a glucose-dependent stimulatory effect of insulin secretion, liraglutide inhibits glucagon secretion and retards gastric emptying. Liraglutide is an anti-diabetic medication used to treat type 2 diabetes, obesity, and chronic weight management. Liraglutide is given by injection under the skin. Liraglutide works by increasing insulin release from the pancreas and decreases excessive glucagon release.

Syd Labs also provides the following GLP-1 receptor agonist biosimilar peptide:
Semaglutide biosimilar

Related Links

See our Privacy Policy