Phone: 1-617-401-8149
Fax: 1-617-606-5019
Email: message@sydlabs.com
Or leave a message with a formal purchase
order (PO) Or credit card.
| Catalog No. | Product Name | Size | List Price (US$) | Quantity |
|---|
Liraglutide biosimilar stable cell line is available for licensing to manufacture the liraglutide biosimilar.
The research grade liraglutide biosimilar is for research use only (RUO).
Price/availability/specifications subject to change without notice. Unless otherwise indicated, our catalog and customized products are for research use only and not intended for human or animal diagnostic or therapeutic use.
Phone: 1-617-401-8149
Fax: 1-617-606-5019
Email: message@sydlabs.com
Or leave a message with a formal purchase
order (PO) Or credit card.
Source: The recombinant peptide liraglutide biosimilar was produced in the liraglutide stable cell line.
Sequence: HAEGTFTSDVSSYLEGQAAKEEFIAWLVRGRG (gamma-E-palmitoyl at E21).
CAS No.: 204656-20-2.
Molecular Formula: C172H265N43O51.
Molecular Weight: 3751.2.
Applications: ELISA, functional assays such as bioanalytical PK and ADA assays, and those assays for studying biological pathways affected by liraglutide.
Form of Peptide: lyophilized from 0.2 uM filtered solution, no stabilizers or preservatives.
Endotoxin: < 1 EU per 1 mg of the peptide by the LAL method.
Purity: >95% by SDS-PAGE under reducing conditions and HPLC.
Shipping: The research grade liraglutide biosimilar is shipped with ice pack. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage: Use a manual defrost freezer and avoid repeated freeze-thaw cycles.
12 months from date of receipt, -20 to -70°C as supplied.
1 month from date of receipt, 2 to 8°C as supplied.
Background
What is research grade liraglutide biosimilar? Research grade liraglutide biosimilar has the same amino acid sequence as Liraglutide, a recombinant peptide which presents 97% homology with human glucagon-like peptide-1 (GLP-1), differing primarily by substituting arginine for lysine at position 34. Liraglutide is made by attaching a C-16 fatty acid (palmitic acid) with a glutamic acid spacer on the remaining lysine residue at position 26 of the peptide precursor. Liraglutide is resistant to the dipeptidylpeptidase-4 enzyme whic degrades the natural hormone. As a glucagon-like peptide-1 receptor agonist (GLP-1 receptor agonist) also known as incretin mimetics, Liraglutide actives the GLP-1 receptor and exerts an incretin mimetic effect during at least 24 hours after a single subcutaneous injection. Besides a glucose-dependent stimulatory effect of insulin secretion, liraglutide inhibits glucagon secretion and retards gastric emptying. Liraglutide is an anti-diabetic medication used to treat type 2 diabetes, obesity, and chronic weight management. Liraglutide is given by injection under the skin. Liraglutide works by increasing insulin release from the pancreas and decreases excessive glucagon release.
Syd Labs also provides the following GLP-1 receptor agonist biosimilar peptide:
Semaglutide biosimilar
Copyright © 2009-2025 sydlabs.com. All rights reserved.
Use of this website means that you have read, understood, and accepted the Syd Labs Privacy Policy and Terms & Conditions.
Friend Link: Ushelf